PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m011131
Common NameLOC8265415, RCOM_1684380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 662aa    MW: 73804.1 Da    PI: 5.8907
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m011131genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.83.5e-1302816461373
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    lv+lL++c+ea+ s++++ +++++a+l el+sp+g+++ Rl+ay+teALa r++r +++++++ +p++ + +  +++ +a +l+++v Pi+kf h+
  30190.m011131 281 LVSLLTACVEAIGSKNMAVINHCIAKLGELSSPKGTAVSRLIAYYTEALALRVTRLWPHIFHISTPRDFD-RVDDDSGTAWRLLNQVNPIPKFIHF 375
                    6899**********************************************************99999998.5677888999*************** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    t N+  l+a+eg+++vHiiDfdi+qGlQWp+L+q+LasR+++p ++RiTg+g+    sk+el+etg+rLa fAe+l++pfef++ v++rled++l+
  30190.m011131 376 TENEIFLRAFEGKDKVHIIDFDIKQGLQWPSLFQSLASRTNPPSHVRITGIGE----SKQELNETGDRLAGFAEALNLPFEFHP-VVDRLEDVRLW 466
                    *****************************************************....***************************.7********** PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                    +L+vk+gE++aVn+v+q+h++l +    +   +++L l++s+sP++v ++eqea+hn++++ +r++++l+yysa+fds++++lp +s  rik+E++
  30190.m011131 467 MLHVKEGESVAVNCVFQMHKTLYDGNGGA--LRDFLGLIRSTSPTIVLMAEQEAEHNATNLEARVCNSLKYYSAIFDSINTSLPLDSLVRIKIEEM 560
                    **********************6554444..589************************************************************** PP

           GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee..sgslvlgWkdrpLvsvSaW 373
                     ++rei+n+vaceg++r erhe++ekWr+ +e+ GF+ + +se+++ q ++ll++++ + yrv+e+  +++l+l W d+pL+++SaW
  30190.m011131 561 -FAREIRNIVACEGSDRLERHESFEKWRKLMEQGGFRCMGISEREVLQSQMLLKMYSCEDYRVKERqdRAALTLSWLDQPLYTISAW 646
                    .********************************************************888****773356777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.749255625IPR005202Transcription factor GRAS
PfamPF035141.2E-127281646IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MLAGCSSSSL LSPRHRLRSE SPAQFQACHF QLPSMSTQRL DLPCTFSRKE SSRSQPIRPV  60
GVGLSVDKSL ESKTTTCSLK QNIRLPPLAT STQSVKDEFW EKGKSLKRFA EQGSVDEPCT  120
NRAKRKRGSS DSCEGGDSLS LGQFGSGNFW FQSGFEVPRG LNPPQAPFSL TCSGDEERVR  180
FVPSDVISPP LPLSNNPWME SVITEITDLG EKDGESSQRP VIKDASGSST SSESHSLGLR  240
PSENVVEYEV GNGSRNPHPQ EGTTEEAAGA NHQEEYQAYE LVSLLTACVE AIGSKNMAVI  300
NHCIAKLGEL SSPKGTAVSR LIAYYTEALA LRVTRLWPHI FHISTPRDFD RVDDDSGTAW  360
RLLNQVNPIP KFIHFTENEI FLRAFEGKDK VHIIDFDIKQ GLQWPSLFQS LASRTNPPSH  420
VRITGIGESK QELNETGDRL AGFAEALNLP FEFHPVVDRL EDVRLWMLHV KEGESVAVNC  480
VFQMHKTLYD GNGGALRDFL GLIRSTSPTI VLMAEQEAEH NATNLEARVC NSLKYYSAIF  540
DSINTSLPLD SLVRIKIEEM FAREIRNIVA CEGSDRLERH ESFEKWRKLM EQGGFRCMGI  600
SEREVLQSQM LLKMYSCEDY RVKERQDRAA LTLSWLDQPL YTISAWAPVD VVGSSSSFSQ  660
PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-462816465374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509714.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLB9RC300.0B9RC30_RICCO; DELLA protein RGL1, putative
STRINGPOPTR_0001s08850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91613244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein